PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29949.m000123
Common NameLOC8284783, RCOM_1120400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 484aa    MW: 52886.1 Da    PI: 7.5356
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29949.m000123genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.48.2e-3099156260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +Dgy+WrKYGqK vkg+ef rsYY+Ct+++C+vkk++ers+ +++vv+i+Y g Hnh+k
  29949.m000123  99 EDGYHWRKYGQKLVKGNEFIRSYYKCTHPNCQVKKQLERSH-NGQVVDIVYFGPHNHPK 156
                    7****************************************.***************85 PP

2WRKY104.84.7e-33267325159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ++Dgy+WrKYGqK vkg+++prsYYrC+s+gCpvkk+ver+++d kvv++ YegeH+he
  29949.m000123 267 VNDGYRWRKYGQKLVKGNPNPRSYYRCSSPGCPVKKHVERASHDSKVVITSYEGEHDHE 325
                    58********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.77993157IPR003657WRKY domain
SuperFamilySSF1182901.44E-2494157IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-2694157IPR003657WRKY domain
SMARTSM007744.2E-3398156IPR003657WRKY domain
PfamPF031061.7E-2399155IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-35253327IPR003657WRKY domain
SuperFamilySSF1182906.93E-29259327IPR003657WRKY domain
PROSITE profilePS5081135.691262327IPR003657WRKY domain
SMARTSM007744.7E-38267326IPR003657WRKY domain
PfamPF031068.5E-26268324IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MVSSGERTDE VASNKLQKGQ SPDNEIHVSQ NQEEVTSVTL EKSLQDPDVS AGVRISQLDK  60
EGSISSIILG KVSQTPGTSS SVTQSGPEER SILREKVTED GYHWRKYGQK LVKGNEFIRS  120
YYKCTHPNCQ VKKQLERSHN GQVVDIVYFG PHNHPKPANN VPLAVGFVLS VVEDRASQPL  180
STSKQEDHVN QLPKSKSNSQ ISTVASSEDV KGVLSESTRI RDEVDNDDDL QSKRQKKGSH  240
NVEPTSVDKP SGEPRLVVQT LSEVDIVNDG YRWRKYGQKL VKGNPNPRSY YRCSSPGCPV  300
KKHVERASHD SKVVITSYEG EHDHEMPPSR TVTHNPTGVN IYTTAVHSGE LGAKSGGSNG  360
VVHNLGSSRN SKEQPSESRN KFKGSHVSGS EIVIFSGSGQ DNKLNQLQNG KSIATEGSDT  420
AGMDKHTVVN TSSVPQGRSN EQHDGESRTE PKVNYSACSV RTITPNAESN PNEKHIPNAE  480
PVQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-3897328275WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583663.10.0PREDICTED: WRKY transcription factor 1
RefseqXP_002533869.10.0PREDICTED: WRKY transcription factor 1
SwissprotQ9SI371e-91WRKY1_ARATH; WRKY transcription factor 1
TrEMBLB9T6K00.0B9T6K0_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0014s16220.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93583343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-94zinc-dependent activator protein-1